PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA003060-PA
Common NameOsI_01003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 854aa    MW: 93387.7 Da    PI: 4.5203
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA003060-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28.1e-185097148
                      TSSS-HH.HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTte.EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+e Ede++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  BGIOSGA003060-PA 50 KGNWTPEeEDEIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWYNHL 97
                      799**862689**********************.*************97 PP

2Myb_DNA-binding48.81.7e-15103145145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       + +WT+eE+  l++a++++G++ W+   + ++ gRt++++k++w+
  BGIOSGA003060-PA 103 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNSIKNHWN 145
                       579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.77345101IPR017930Myb domain
SuperFamilySSF466894.49E-2848144IPR009057Homeodomain-like
SMARTSM007175.2E-154999IPR001005SANT/Myb domain
PfamPF002491.0E-155097IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-2451105IPR009057Homeodomain-like
CDDcd001679.46E-155297No hitNo description
SMARTSM007172.2E-14102150IPR001005SANT/Myb domain
PROSITE profilePS5129419.815102152IPR017930Myb domain
PfamPF002495.4E-14103146IPR001005SANT/Myb domain
CDDcd001673.37E-11105145No hitNo description
Gene3DG3DSA:1.10.10.602.1E-21106152IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 854 aa     Download sequence    Send to blast
MESLLDLRWL LKKEKSATNQ KGDDLSMGKR LKALLTIVMR TTGPTRRSTK GNWTPEEEDE  60
IIVQMVNKLG PKKWSTIAQA LPGRIGKQCR ERWYNHLNPG INKEAWTQEE EITLIHAHRM  120
YGNKWAELTK FLPGRTDNSI KNHWNSSVKK KVNSYMSSGL LTQVSCLPLN EYSANCNSSP  180
AMTQQNSEDS GCFAVREVEN SSGCSQSSLA KVSCSQVHDN TVPLGCDLQV NTNFDKNEAH  240
DSQSSMGSEA CYTSAEAVAS ALPAVHCHVS SSNLDPDQHL QEDFAQGLNL DMTIDEMPTV  300
PSFADNQTVC SIENHERSLE PYDVAMEVPL SMLSSDSGAE QKLHFMSEAD FNSPNCLKSE  360
LWQDISLQGL LSGPDAVEAD SFSRSNHQSD VYSSEADTHF LAPPYMPQAS NSSSVMGVAD  420
DQSPQMSVPP SLICSNVMTD DAPFDNRPGR KEMPLSQAEV VTQSSSSSGD AEMFANPGCS  480
NDRHVPSSTM ESIPECGDQQ VTNAEEPEAS LEKEPSLTQS VTAPDEQDKG ALFYEPPRFP  540
SLDVPFVSCD LVTSGDLQEF SPLGIRQLMH STMNFCVLSD LLLLKSLEKK LVFSDENKEN  600
LGYTTEQTKD GQSAGNDEHM DEQTTGERSS ATNVATNDDL SGNLQPAGIL IEHSGDDPIS  660
PDYGKNTMNQ KLNTNVKSLS VCKEGVCAKS KPTELIVEKS SPCINVDYEY VNILADTPGI  720
KRGLESPSAW KSPWFVDMHF QGSYFTSPAD SYDALGLMKQ INVQTAAALV EAREVLASGG  780
QCDNISSDKE NTGNPDAKKE PGTTKLQTKI MAEGRVLDFE CTTPVRSSDK NAGSSLGRYL  840
SSPIPSSHLL KSFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-43501524105C-Myb DNA-Binding Domain
1msf_C5e-43501524105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.223730.0callus| flower| panicle| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3186010.0AK318601.1 Oryza sativa Japonica Group cDNA, clone: J100066E24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625869.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLB8AB030.0B8AB03_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA003060-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.24e-69myb domain protein 3r-4